PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004486190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family TALE
Protein Properties Length: 383aa    MW: 42941.9 Da    PI: 6.3715
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004486190.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.5e-093093451955
                     HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +k +yps++++  LA+++gL+++q+ +WF N+R ++
  XP_004486190.1 309 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 345
                     45679*****************************885 PP

2ELK413.9e-14265286122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  XP_004486190.1 265 ELKGQLLRKYSGYLGSLKQEFM 286
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.1E-19126170IPR005540KNOX1
PfamPF037905.2E-20128166IPR005540KNOX1
SMARTSM012563.1E-26177228IPR005541KNOX2
PfamPF037912.2E-21181227IPR005541KNOX2
PROSITE profilePS5121311.174265285IPR005539ELK domain
PfamPF037896.4E-11265286IPR005539ELK domain
SMARTSM011882.8E-8265286IPR005539ELK domain
PROSITE profilePS5007113.086285348IPR001356Homeobox domain
SuperFamilySSF466891.8E-19287363IPR009057Homeodomain-like
SMARTSM003891.2E-12287352IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.1E-28290350IPR009057Homeodomain-like
CDDcd000861.32E-12297349No hitNo description
PfamPF059207.0E-17305344IPR008422Homeobox KN domain
PROSITE patternPS000270323346IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MEGSSNGTSS YVMAFGENSG GLCPMMMMPL VTSTSHHATT THHPLNNNNN NINTTNTTNA  60
NTNSLFLPIS STNNNNLFTN CNNTTVGNNT TSSIMFHNNN NTPGLGYYFM DNNNNNNNGS  120
SSSSSSSVKA KIMAHPHYHR LLEAYINCQK VGAPGEVVVR LEEACASAVT MGGDAVGSGC  180
LGEDPALDQF MEAYCEMLIK YEQELSKPFK EAMLFLQRIE SQFKNLTISS SDNIGCNEGG  240
GDRNGSSEED VDLYNMIDPQ AEDRELKGQL LRKYSGYLGS LKQEFMKKRK KGKLPKEARQ  300
QLLEWWSRHY KWPYPSESQK LALAESTGLD QKQINNWFIN QRKRHWKPSE DMQFVVMDPS  360
HPHYYMDNVL TNPFSMDLPN TML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1280289LKQEFMKKRK
2286290KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3084540.0AF308454.1 Medicago truncatula knotted class I homeodomain KNOX mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004486190.10.0PREDICTED: homeobox protein SBH1
SwissprotP466081e-178HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLO828050.0O82805_PEA; Knotted1-like class I homeodomain protein
STRINGGLYMA09G01000.21e-176(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-132KNOX/ELK homeobox transcription factor